Lineage for d5drxb2 (5drx B:113-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750821Domain d5drxb2: 5drx B:113-219 [323341]
    Other proteins in same PDB: d5drxa1, d5drxa2, d5drxb1, d5drxh1, d5drxh2, d5drxl1
    automated match to d1dn0a2
    complexed with gol

Details for d5drxb2

PDB Entry: 5drx (more details), 2.1 Å

PDB Description: crystal structure of the bcr fab fragment from subset #4 case cll240
PDB Compounds: (B:) CLL240 BCR light chain

SCOPe Domain Sequences for d5drxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5drxb2 b.1.1.2 (B:113-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5drxb2:

Click to download the PDB-style file with coordinates for d5drxb2.
(The format of our PDB-style files is described here.)

Timeline for d5drxb2: