SCOPe 2.06: Domain d5f3hf1: 5f3h F:1-106

Lineage for d5f3hf1 (5f3h F:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5f3hf1: 5f3h F:1-106 [323312]
   Other proteins in same PDB: d5f3hb2, d5f3hd2, d5f3hf2, d5f3hh2, d5f3hi_, d5f3hj_, d5f3hk_, d5f3hl_
   automated match to d1dn0a1

Details for d5f3hf1

PDB Entry: 5f3h, 2.7 Å

PDB Description: structure of myostatin in complex with humanized rk35 antibody

PDB Compounds: (F:) humanized RK35 antibody light chain

SCOPe Domain Sequences for d5f3hf1:

Sequence; same for both SEQRES and ATOM records:

>d5f3hf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsasvgdrvtitckasqdvstavawyqqkpgkapklliysasyrytgvps
rfsgsgsgtdftltisslnpedfatyycqqhystpwtfgggtkvei

Timeline for d5f3hf1:

• d5f3hf1 is new in SCOPe 2.06-stable
  
• d5f3hf1 appears in SCOPe 2.07
  
• d5f3hf1 appears in the current release, SCOPe 2.08