Lineage for d5g5ha2 (5g5h A:139-225)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324036Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2324037Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2324144Family a.56.1.0: automated matches [227241] (1 protein)
    not a true family
  6. 2324145Protein automated matches [227007] (6 species)
    not a true protein
  7. 2324148Species Escherichia coli [TaxId:83333] [323304] (2 PDB entries)
  8. 2324150Domain d5g5ha2: 5g5h A:139-225 [323305]
    Other proteins in same PDB: d5g5ha1
    automated match to d1qj2a4
    complexed with act, cl, csd, fad, fes, gol, iod, mcn, mos, sf4; mutant

Details for d5g5ha2

PDB Entry: 5g5h (more details), 2.3 Å

PDB Description: escherichia coli periplasmic aldehyde oxidase r440h mutant
PDB Compounds: (A:) putative xanthine dehydrogenase yagt iron-sulfur-binding subunit

SCOPe Domain Sequences for d5g5ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ha2 a.56.1.0 (A:139-225) automated matches {Escherichia coli [TaxId: 83333]}
spdnlhpmqaafikhdgfqcgyctsgqicssvavlkeiqdgipshvtvdlvsapettade
irermsgnicrcgayanilaaiedaag

SCOPe Domain Coordinates for d5g5ha2:

Click to download the PDB-style file with coordinates for d5g5ha2.
(The format of our PDB-style files is described here.)

Timeline for d5g5ha2: