Lineage for d5chfc2 (5chf C:77-150)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178913Species Mouse (Mus musculus) [TaxId:10090] [189205] (11 PDB entries)
  8. 2178949Domain d5chfc2: 5chf C:77-150 [323290]
    automated match to d3pseb2
    complexed with gol, so4

Details for d5chfc2

PDB Entry: 5chf (more details), 2.3 Å

PDB Description: crystal structure of murine isg15 in space group p21212
PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5chfc2 d.15.1.0 (C:77-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg
eyglkpqctvikhl

SCOPe Domain Coordinates for d5chfc2:

Click to download the PDB-style file with coordinates for d5chfc2.
(The format of our PDB-style files is described here.)

Timeline for d5chfc2: