Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
Domain d5dpsa_: 5dps A: [323287] automated match to d3wanb_ |
PDB Entry: 5dps (more details), 2 Å
SCOPe Domain Sequences for d5dpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dpsa_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvps dltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdes vy
Timeline for d5dpsa_: