Lineage for d5dpsa_ (5dps A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (88 PDB entries)
  8. 2502671Domain d5dpsa_: 5dps A: [323287]
    automated match to d3wanb_

Details for d5dpsa_

PDB Entry: 5dps (more details), 2 Å

PDB Description: crystal structure of plekhm1 lir-fused human gabarap_2-117
PDB Compounds: (A:) Pleckstrin homology domain-containing family M member 1,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d5dpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpsa_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvps
dltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdes
vy

SCOPe Domain Coordinates for d5dpsa_:

Click to download the PDB-style file with coordinates for d5dpsa_.
(The format of our PDB-style files is described here.)

Timeline for d5dpsa_: