Lineage for d1bmfc3 (1bmf C:95-379)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70095Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 70110Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 70114Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 70135Domain d1bmfc3: 1bmf C:95-379 [32328]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfb1, d1bmfb2, d1bmfc1, d1bmfc2, d1bmfd1, d1bmfd2, d1bmfe1, d1bmfe2, d1bmff1, d1bmff2, d1bmfg_

Details for d1bmfc3

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfc3 c.37.1.11 (C:95-379) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1bmfc3:

Click to download the PDB-style file with coordinates for d1bmfc3.
(The format of our PDB-style files is described here.)

Timeline for d1bmfc3: