SCOPe 2.08: Domain d5e3ba_: 5e3b A:

Lineage for d5e3ba_ (5e3b A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [323276] (1 PDB entry)

8. Domain d5e3ba_: 5e3b A: [323277]
   automated match to d2afca1
   complexed with edo, na

Details for d5e3ba_

PDB Entry: 5e3b, 1.6 Å

PDB Description: structure of macrodomain protein from streptomyces coelicolor

PDB Compounds: (A:) Macrodomain protein

SCOPe Domain Sequences for d5e3ba_:

Sequence, based on SEQRES records:

>d5e3ba_ c.50.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
eisyvrgdatapsvkgvkmiahvcndlggwgkgfvlavsrrwpqpeaayrawhrdraand
fglgavqfvqvepyvwvanmigqhgmktgskgapvryeaigtalgrvadraaeleasvhl
prigcglaggtwsrveplisdrltrrgipvtvydhg

Sequence, based on observed residues (ATOM records):

>d5e3ba_ c.50.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
eisyvrgdatapsvkgvkmiahvcndlggwgkgfvlavsrrwpqpeaayrawhrdraand
fglgavqfvqvepyvwvanmigqhgmkpvryeaigtalgrvadraaeleasvhlprigla
ggtwsrveplisdrltrrgipvtvydhg

Timeline for d5e3ba_:

• d5e3ba_ first appeared in SCOPe 2.06
  
• d5e3ba_ appears in SCOPe 2.07