Lineage for d5chva_ (5chv A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 2498157Species Mouse (Mus musculus) [TaxId:10090] [318905] (2 PDB entries)
  8. 2498160Domain d5chva_: 5chv A: [323272]
    Other proteins in same PDB: d5chvc1, d5chvc2, d5chvd1, d5chvd2
    automated match to d2ibia1
    complexed with cl, so4, zn

Details for d5chva_

PDB Entry: 5chv (more details), 3.01 Å

PDB Description: crystal structure of usp18-isg15 complex
PDB Compounds: (A:) Ubl carboxyl-terminal hydrolase 18

SCOPe Domain Sequences for d5chva_:

Sequence, based on SEQRES records: (download)

>d5chva_ d.3.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekmq
dsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglftiw
tqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcces
cgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlpteedlg
dtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctyg
nhryrwretayllvytkt

Sequence, based on observed residues (ATOM records): (download)

>d5chva_ d.3.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekmq
dsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglftiw
tqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcces
cgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlihyelfa
viahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllv
ytkt

SCOPe Domain Coordinates for d5chva_:

Click to download the PDB-style file with coordinates for d5chva_.
(The format of our PDB-style files is described here.)

Timeline for d5chva_: