SCOPe 2.08: Domain d5chvc1: 5chv C:2-76

Lineage for d5chvc1 (5chv C:2-76)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d5chvc1: 5chv C:2-76 [323270]
   Other proteins in same PDB: d5chva_, d5chvb_
   automated match to d3pseb1
   complexed with cl, so4, zn

Details for d5chvc1

PDB Entry: 5chv, 3.01 Å

PDB Description: crystal structure of usp18-isg15 complex

PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chvc1:

Sequence; same for both SEQRES and ATOM records:

>d5chvc1 d.15.1.0 (C:2-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
glgpsstvmlvvqns

Timeline for d5chvc1:

• d5chvc1 first appeared in SCOPe 2.06
  
• d5chvc1 appears in SCOPe 2.07