Lineage for d1bmfb3 (1bmf B:95-379)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869484Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2869503Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 2869529Domain d1bmfb3: 1bmf B:95-379 [32327]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfb1, d1bmfb2, d1bmfc1, d1bmfc2, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_
    complexed with adp, anp, mg

Details for d1bmfb3

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase
PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1bmfb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfb3 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1bmfb3:

Click to download the PDB-style file with coordinates for d1bmfb3.
(The format of our PDB-style files is described here.)

Timeline for d1bmfb3: