SCOPe 2.08: Domain d5dq0a1: 5dq0 A:277-430

Lineage for d5dq0a1 (5dq0 A:277-430)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)

8. Domain d5dq0a1: 5dq0 A:277-430 [323268]
   Other proteins in same PDB: d5dq0a2
   automated match to d1kexa_
   complexed with cl, edo, mes, zn

Details for d5dq0a1

PDB Entry: 5dq0, 1.8 Å

PDB Description: structure of human neuropilin-2 b1 domain with novel and unique zinc binding site

PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d5dq0a1:

Sequence; same for both SEQRES and ATOM records:

>d5dq0a1 b.18.1.0 (A:277-430) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrfl
tmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvln
klhaplltrfvrirpqtwhsgialrlelfgcrvt

Timeline for d5dq0a1:

• d5dq0a1 first appeared in SCOPe 2.06
  
• d5dq0a1 appears in SCOPe 2.07