Lineage for d5b2ca_ (5b2c A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2398492Protein automated matches [193245] (17 species)
    not a true protein
  7. 2398596Species Mumps virus [TaxId:11161] [323195] (2 PDB entries)
  8. 2398599Domain d5b2ca_: 5b2c A: [323196]
    automated match to d1e8ub_
    complexed with nag, so4

Details for d5b2ca_

PDB Entry: 5b2c (more details), 2.24 Å

PDB Description: crystal structure of mumps virus hemagglutinin-neuraminidase
PDB Compounds: (A:) HN protein

SCOPe Domain Sequences for d5b2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2ca_ b.68.1.1 (A:) automated matches {Mumps virus [TaxId: 11161]}
plvndlrfinginkfiiedyathdfsighplnmpsfiptatspngctripsfslgkthwc
ythnvinanckdhtssnqyismgilvqtasgypmfktlkiqylsdglnrkscsiatvpdg
camycyvstqletddyagsspptqkltllfyndtvtertisptglegnwatlvpgvgsgi
yfenklifpayggvlpnstlgvksareffrpvnpynpcsgpqqdldqralrsyfpsyfsn
rrvqsaflvcawnqilvtncelvvpsnnqtlmgaegrvllinnrllyyqrstswwpyell
yeisftftnsgqssvnmswipiysftrpgsgncsgenvcptacvsgvyldpwpltpyshq
sginrnfyftgallnssttrvnptlyvsalnnlkvlapygnqglfasyttttcfqdtgda
svycvyimelasnivgefqilpvltrltit

SCOPe Domain Coordinates for d5b2ca_:

Click to download the PDB-style file with coordinates for d5b2ca_.
(The format of our PDB-style files is described here.)

Timeline for d5b2ca_: