SCOPe 2.06: Domain d5ik2o_: 5ik2 O:

Lineage for d5ik2o_ (5ik2 O:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.0: automated matches [191450] (1 protein)
   not a true family

6. Protein automated matches [190687] (2 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322942] (2 PDB entries)

8. Domain d5ik2o_: 5ik2 O: [323177]
   Other proteins in same PDB: d5ik2a1, d5ik2a2, d5ik2a3, d5ik2b1, d5ik2b2, d5ik2b3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2e1, d5ik2e2, d5ik2e3, d5ik2f1, d5ik2f2, d5ik2f3, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3
   automated match to d2v7qg_
   complexed with adp, gol, mg, po4; mutant

Details for d5ik2o_

PDB Entry: 5ik2, 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)

PDB Compounds: (O:) ATP synthase gamma chain

SCOPe Domain Sequences for d5ik2o_:

Sequence; same for both SEQRES and ATOM records:

>d5ik2o_ c.49.2.0 (O:) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
qgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtk
dfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrk
grdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivq
rpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgar
mtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr

Timeline for d5ik2o_:

• d5ik2o_ is new in SCOPe 2.06-stable
  
• d5ik2o_ appears in SCOPe 2.07
  
• d5ik2o_ appears in the current release, SCOPe 2.08