Lineage for d5g6ca_ (5g6c A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3004094Protein automated matches [190421] (6 species)
    not a true protein
  7. 3004100Species Bacillus subtilis [TaxId:224308] [228529] (76 PDB entries)
  8. 3004170Domain d5g6ca_: 5g6c A: [323176]
    automated match to d4d3ia_
    complexed with cl, gol, h4b, hem, m48

Details for d5g6ca_

PDB Entry: 5g6c (more details), 2.13 Å

PDB Description: structure of bacillus subtilis nitric oxide synthase i218v in complex with 7-((3-fluorophenethylamino)ethyl)quinolin-2-amine
PDB Compounds: (A:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d5g6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g6ca_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpivsdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

SCOPe Domain Coordinates for d5g6ca_:

Click to download the PDB-style file with coordinates for d5g6ca_.
(The format of our PDB-style files is described here.)

Timeline for d5g6ca_: