SCOPe 2.06: Domain d5ks9a2: 5ks9 A:82-180

Lineage for d5ks9a2 (5ks9 A:82-180)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d5ks9a2: 5ks9 A:82-180 [323166]
Other proteins in same PDB: d5ks9a1, d5ks9b1, d5ks9b2, d5ks9c1, d5ks9d1, d5ks9d2, d5ks9e1, d5ks9f1, d5ks9g1
automated match to d4z7va2
complexed with ca, nag

Details for d5ks9a2

PDB Entry: 5ks9 (more details), 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex

PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ks9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ks9a2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwep

SCOPe Domain Coordinates for d5ks9a2:

Click to download the PDB-style file with coordinates for d5ks9a2.
(The format of our PDB-style files is described here.)

Timeline for d5ks9a2: