![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
![]() | Protein automated matches [190561] (4 species) not a true protein |
![]() | Species Monosiga brevicollis [TaxId:81824] [323144] (1 PDB entry) |
![]() | Domain d2rvfa1: 2rvf A:2-97 [323145] Other proteins in same PDB: d2rvfa2 automated match to d1mila_ |
PDB Entry: 2rvf (more details)
SCOPe Domain Sequences for d2rvfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rvfa1 d.93.1.0 (A:2-97) automated matches {Monosiga brevicollis [TaxId: 81824]} aeaaapwyhgplsrtdaensllrmpegtflvrdstsspgdyvlscsengkvthyklsaee gkiridthlfdnldaaitfymeheleysslkqplqr
Timeline for d2rvfa1: