Lineage for d2rvfa1 (2rvf A:2-97)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572516Species Monosiga brevicollis [TaxId:81824] [323144] (1 PDB entry)
  8. 2572517Domain d2rvfa1: 2rvf A:2-97 [323145]
    Other proteins in same PDB: d2rvfa2
    automated match to d1mila_

Details for d2rvfa1

PDB Entry: 2rvf (more details)

PDB Description: solution nmr structure of monosiga brevicollis crk/crkl homolog (crka1) sh2 domain
PDB Compounds: (A:) Predicted protein

SCOPe Domain Sequences for d2rvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rvfa1 d.93.1.0 (A:2-97) automated matches {Monosiga brevicollis [TaxId: 81824]}
aeaaapwyhgplsrtdaensllrmpegtflvrdstsspgdyvlscsengkvthyklsaee
gkiridthlfdnldaaitfymeheleysslkqplqr

SCOPe Domain Coordinates for d2rvfa1:

Click to download the PDB-style file with coordinates for d2rvfa1.
(The format of our PDB-style files is described here.)

Timeline for d2rvfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rvfa2