SCOPe 2.08: Domain d5ks9g2: 5ks9 G:130-210

Lineage for d5ks9g2 (5ks9 G:130-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ks9g2: 5ks9 G:130-210 [323141]
   Other proteins in same PDB: d5ks9a1, d5ks9b1, d5ks9b2, d5ks9c1, d5ks9d1, d5ks9d2, d5ks9e1, d5ks9f1, d5ks9g1, d5ks9h1
   automated match to d2pyfa2
   complexed with ca, nag

Details for d5ks9g2

PDB Entry: 5ks9, 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex

PDB Compounds: (G:) Bel502 TCR alpha TRAV20*01

SCOPe Domain Sequences for d5ks9g2:

Sequence; same for both SEQRES and ATOM records:

>d5ks9g2 b.1.1.2 (G:130-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsii

Timeline for d5ks9g2:

• d5ks9g2 first appeared in SCOPe 2.06
  
• d5ks9g2 appears in SCOPe 2.07