Lineage for d5ik2j1 (5ik2 J:26-95)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067404Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries)
  8. 2067412Domain d5ik2j1: 5ik2 J:26-95 [323131]
    Other proteins in same PDB: d5ik2a2, d5ik2a3, d5ik2b2, d5ik2b3, d5ik2c2, d5ik2c3, d5ik2d2, d5ik2d3, d5ik2e2, d5ik2e3, d5ik2f2, d5ik2f3, d5ik2g_, d5ik2i2, d5ik2i3, d5ik2j2, d5ik2j3, d5ik2k2, d5ik2k3, d5ik2l2, d5ik2l3, d5ik2m2, d5ik2m3, d5ik2n2, d5ik2n3, d5ik2o_
    automated match to d1skyb2
    complexed with adp, gol, mg, po4; mutant

Details for d5ik2j1

PDB Entry: 5ik2 (more details), 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)
PDB Compounds: (J:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5ik2j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik2j1 b.49.1.0 (J:26-95) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
vevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteireg
tqvkrtgrim

SCOPe Domain Coordinates for d5ik2j1:

Click to download the PDB-style file with coordinates for d5ik2j1.
(The format of our PDB-style files is described here.)

Timeline for d5ik2j1: