Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein automated matches [190421] (6 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [228529] (76 PDB entries) |
Domain d5g6ga_: 5g6g A: [323128] automated match to d4d3ia_ complexed with cl, h4b, h8b, hem |
PDB Entry: 5g6g (more details), 1.98 Å
SCOPe Domain Sequences for d5g6ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g6ga_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp ye
Timeline for d5g6ga_: