Lineage for d5ksad2 (5ksa D:130-257)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (888 PDB entries)
  8. 2352863Domain d5ksad2: 5ksa D:130-257 [323121]
    Other proteins in same PDB: d5ksaa1, d5ksab1, d5ksab2, d5ksac1, d5ksad1
    automated match to d3of6b2
    complexed with ca, nag

Details for d5ksad2

PDB Entry: 5ksa (more details), 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (D:) Bel602 beta TRBV9*01

SCOPe Domain Sequences for d5ksad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksad2 b.1.1.2 (D:130-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d5ksad2:

Click to download the PDB-style file with coordinates for d5ksad2.
(The format of our PDB-style files is described here.)

Timeline for d5ksad2: