Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d5ksbd1: 5ksb D:2-92 [323108] Other proteins in same PDB: d5ksba2, d5ksbb2, d5ksbc2, d5ksbd2, d5ksbe1, d5ksbe2, d5ksbf1, d5ksbf2, d5ksbg1, d5ksbg2, d5ksbh1, d5ksbh2 automated match to d1klub2 complexed with nag |
PDB Entry: 5ksb (more details), 2.9 Å
SCOPe Domain Sequences for d5ksbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ksbd1 d.19.1.0 (D:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw nsqkevlertraeldtvcrhnyqlelrttlq
Timeline for d5ksbd1: