SCOPe 2.06: Domain d5ksbd1: 5ksb D:2-92

Lineage for d5ksbd1 (5ksb D:2-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5ksbd1: 5ksb D:2-92 [323108]
   Other proteins in same PDB: d5ksba2, d5ksbb2, d5ksbc2, d5ksbd2, d5ksbe1, d5ksbe2, d5ksbf1, d5ksbf2, d5ksbg1, d5ksbg2, d5ksbh1, d5ksbh2
   automated match to d1klub2
   complexed with nag

Details for d5ksbd1

PDB Entry: 5ksb, 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex

PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ksbd1:

Sequence; same for both SEQRES and ATOM records:

>d5ksbd1 d.19.1.0 (D:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
nsqkevlertraeldtvcrhnyqlelrttlq

Timeline for d5ksbd1:

• d5ksbd1 is new in SCOPe 2.06-stable
  
• d5ksbd1 appears in SCOPe 2.07
  
• d5ksbd1 appears in the current release, SCOPe 2.08