SCOPe 2.08: Domain d5ld0a1: 5ld0 A:2-80

Lineage for d5ld0a1 (5ld0 A:2-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
   Uniprot P08263

8. Domain d5ld0a1: 5ld0 A:2-80 [323055]
   Other proteins in same PDB: d5ld0a2
   automated match to d1f3ba2
   complexed with cl

Details for d5ld0a1

PDB Entry: 5ld0, 1.6 Å

PDB Description: chimeric gst

PDB Compounds: (A:) Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1

SCOPe Domain Sequences for d5ld0a1:

Sequence; same for both SEQRES and ATOM records:

>d5ld0a1 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d5ld0a1:

• d5ld0a1 first appeared in SCOPe 2.06
  
• d5ld0a1 appears in SCOPe 2.07