Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d5ks9b1: 5ks9 B:2-92 [323050] Other proteins in same PDB: d5ks9a2, d5ks9b2, d5ks9c2, d5ks9d2, d5ks9e1, d5ks9e2, d5ks9f1, d5ks9f2, d5ks9g1, d5ks9g2 automated match to d1klub2 complexed with ca, nag |
PDB Entry: 5ks9 (more details), 2.55 Å
SCOPe Domain Sequences for d5ks9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ks9b1 d.19.1.0 (B:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw nsqkevlertraeldtvcrhnyqlelrttlq
Timeline for d5ks9b1: