SCOPe 2.06: Domain d5ksac2: 5ksa C:130-212

Lineage for d5ksac2 (5ksa C:130-212)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d5ksac2: 5ksa C:130-212 [323046]
Other proteins in same PDB: d5ksaa1, d5ksab1, d5ksab2, d5ksac1, d5ksad1
automated match to d2pyfa2
complexed with ca, nag

Details for d5ksac2

PDB Description: bel602-dq8.5-glia-gamma1 complex

PDB Compounds: (C:) Bel602 alpha TRAV20*01

SCOPe Domain Sequences for d5ksac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksac2 b.1.1.2 (C:130-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipe

SCOPe Domain Coordinates for d5ksac2:

Click to download the PDB-style file with coordinates for d5ksac2.
(The format of our PDB-style files is described here.)

Timeline for d5ksac2: