SCOPe 2.06: Domain d5ksbe2: 5ksb E:130-218

Lineage for d5ksbe2 (5ksb E:130-218)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

Domain d5ksbe2: 5ksb E:130-218 [323041]
Other proteins in same PDB: d5ksba1, d5ksbb1, d5ksbb2, d5ksbc1, d5ksbd1, d5ksbd2, d5ksbe1, d5ksbf1, d5ksbg1, d5ksbh1
automated match to d2pyfa2
complexed with nag

Details for d5ksbe2

PDB Entry: 5ksb (more details), 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex

PDB Compounds: (E:) T15 TCR alpha TRAV20*02

SCOPe Domain Sequences for d5ksbe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksbe2 b.1.1.2 (E:130-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d5ksbe2:

Click to download the PDB-style file with coordinates for d5ksbe2.
(The format of our PDB-style files is described here.)

Timeline for d5ksbe2: