Lineage for d5ksaa1 (5ksa A:0-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 2507582Domain d5ksaa1: 5ksa A:0-81 [323032]
    Other proteins in same PDB: d5ksaa2, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2
    automated match to d4ozfa1
    complexed with ca, nag

Details for d5ksaa1

PDB Entry: 5ksa (more details), 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksaa1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d5ksaa1:

Click to download the PDB-style file with coordinates for d5ksaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ksaa1: