Lineage for d5ksbc2 (5ksb C:82-180)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (888 PDB entries)
  8. 2353642Domain d5ksbc2: 5ksb C:82-180 [323029]
    Other proteins in same PDB: d5ksba1, d5ksbb1, d5ksbb2, d5ksbc1, d5ksbd1, d5ksbd2, d5ksbe1, d5ksbf1, d5ksbg1, d5ksbh1
    automated match to d4ozfa2
    complexed with nag

Details for d5ksbc2

PDB Entry: 5ksb (more details), 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex
PDB Compounds: (C:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksbc2 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwep

SCOPe Domain Coordinates for d5ksbc2:

Click to download the PDB-style file with coordinates for d5ksbc2.
(The format of our PDB-style files is described here.)

Timeline for d5ksbc2: