Lineage for d5ksbf1 (5ksb F:3-129)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 2357407Domain d5ksbf1: 5ksb F:3-129 [323015]
    Other proteins in same PDB: d5ksba1, d5ksba2, d5ksbb1, d5ksbc1, d5ksbc2, d5ksbd1, d5ksbe2, d5ksbf2, d5ksbg2, d5ksbh2
    automated match to d3of6c1
    complexed with nag

Details for d5ksbf1

PDB Entry: 5ksb (more details), 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex
PDB Compounds: (F:) T15 TCR beta TRBV9*01

SCOPe Domain Sequences for d5ksbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksbf1 b.1.1.0 (F:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
rfsaqqfpdlhselnlsslelgdsalyfcassnrglgtdtqyfgpgtrltvled

SCOPe Domain Coordinates for d5ksbf1:

Click to download the PDB-style file with coordinates for d5ksbf1.
(The format of our PDB-style files is described here.)

Timeline for d5ksbf1: