Lineage for d5jwua_ (5jwu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2925652Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2926350Protein automated matches [193860] (2 species)
    not a true protein
  7. 2926373Species Enterobacteria phage [TaxId:348604] [322994] (7 PDB entries)
  8. 2926379Domain d5jwua_: 5jwu A: [322995]
    automated match to d4w59a_
    complexed with b20, cl

Details for d5jwua_

PDB Entry: 5jwu (more details), 1.7 Å

PDB Description: t4 lysozyme l99a/m102q with 1,2-dihydro-1,2-azaborine bound
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d5jwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jwua_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 348604]}
mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpdrakrvittfrtgtwday

SCOPe Domain Coordinates for d5jwua_:

Click to download the PDB-style file with coordinates for d5jwua_.
(The format of our PDB-style files is described here.)

Timeline for d5jwua_: