Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins) |
Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species) |
Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries) |
Domain d1e0kc_: 1e0k C: [32298] |
PDB Entry: 1e0k (more details), 3.3 Å
SCOP Domain Sequences for d1e0kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0kc_ c.37.1.11 (C:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7} pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
Timeline for d1e0kc_: