Lineage for d1e0kc_ (1e0k C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 180075Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 180076Species Bacteriophage T7 [TaxId:10760] [52675] (6 PDB entries)
  8. 180089Domain d1e0kc_: 1e0k C: [32298]

Details for d1e0kc_

PDB Entry: 1e0k (more details), 3.3 Å

PDB Description: gp4d helicase from phage t7

SCOP Domain Sequences for d1e0kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0kc_ c.37.1.11 (C:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7}
pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

SCOP Domain Coordinates for d1e0kc_:

Click to download the PDB-style file with coordinates for d1e0kc_.
(The format of our PDB-style files is described here.)

Timeline for d1e0kc_: