SCOPe 2.08: Domain d5ik2e1: 5ik2 E:1-76

Lineage for d5ik2e1 (5ik2 E:1-76)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries)

8. Domain d5ik2e1: 5ik2 E:1-76 [322961]
   Other proteins in same PDB: d5ik2a2, d5ik2a3, d5ik2b2, d5ik2b3, d5ik2c2, d5ik2c3, d5ik2d2, d5ik2d3, d5ik2e2, d5ik2e3, d5ik2f2, d5ik2f3, d5ik2g_, d5ik2i2, d5ik2i3, d5ik2j2, d5ik2j3, d5ik2k2, d5ik2k3, d5ik2l2, d5ik2l3, d5ik2m2, d5ik2m3, d5ik2n2, d5ik2n3, d5ik2o_
   automated match to d2qe7d1
   complexed with adp, gol, mg, po4; mutant

Details for d5ik2e1

PDB Entry: 5ik2, 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d5ik2e1:

Sequence; same for both SEQRES and ATOM records:

>d5ik2e1 b.49.1.0 (E:1-76) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
tdglvrgleavdtgap

Timeline for d5ik2e1:

• d5ik2e1 first appeared in SCOPe 2.06
  
• d5ik2e1 appears in SCOPe 2.07