Lineage for d5eoob_ (5eoo B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014929Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries)
  8. 3014950Domain d5eoob_: 5eoo B: [322948]
    automated match to d4mxga_
    complexed with cit, cl, ipa, mrd, pge

Details for d5eoob_

PDB Entry: 5eoo (more details), 1.48 Å

PDB Description: crystal structure of extended-spectrum beta-lactamase bel-1 (monoclinic form)
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5eoob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eoob_ e.3.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage
enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl
ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql
rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape
lqgeeralliasvaklarqyv

SCOPe Domain Coordinates for d5eoob_:

Click to download the PDB-style file with coordinates for d5eoob_.
(The format of our PDB-style files is described here.)

Timeline for d5eoob_: