SCOPe 2.08: Domain d5hkka2: 5hkk A:95-371

Lineage for d5hkka2 (5hkk A:95-371)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322895] (1 PDB entry)

8. Domain d5hkka2: 5hkk A:95-371 [322927]
   Other proteins in same PDB: d5hkka1, d5hkka3, d5hkkb1, d5hkkb3, d5hkkc1, d5hkkc3, d5hkkd1, d5hkkd2, d5hkkd3, d5hkke1, d5hkke2, d5hkke3, d5hkkf1, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki1, d5hkki3, d5hkkj1, d5hkkj3, d5hkkk1, d5hkkk3, d5hkkl1, d5hkkl2, d5hkkl3, d5hkkm1, d5hkkm2, d5hkkm3, d5hkkn1, d5hkkn2, d5hkkn3, d5hkko_
   automated match to d1maba3
   complexed with adp, atp, gol, mg, po4

Details for d5hkka2

PDB Entry: 5hkk, 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)

PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5hkka2:

Sequence; same for both SEQRES and ATOM records:

>d5hkka2 c.37.1.0 (A:95-371) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
mevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvheplqtgikaid
smipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstvagvvetlrq
hdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskqaaayrels
lllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdvsayiptnv
isitdgqiflesdlfysgvrpavnvgisvsrvggaaq

Timeline for d5hkka2:

• d5hkka2 first appeared in SCOPe 2.06
  
• d5hkka2 appears in SCOPe 2.07