SCOPe 2.08: Domain d5hkkl2: 5hkk L:77-349

Lineage for d5hkkl2 (5hkk L:77-349)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein automated matches [190393] (12 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322910] (2 PDB entries)

8. Domain d5hkkl2: 5hkk L:77-349 [322911]
   Other proteins in same PDB: d5hkka1, d5hkka2, d5hkka3, d5hkkb1, d5hkkb2, d5hkkb3, d5hkkc1, d5hkkc2, d5hkkc3, d5hkkd1, d5hkkd3, d5hkke1, d5hkke3, d5hkkf1, d5hkkf3, d5hkkg_, d5hkki1, d5hkki2, d5hkki3, d5hkkj1, d5hkkj2, d5hkkj3, d5hkkk1, d5hkkk2, d5hkkk3, d5hkkl1, d5hkkl3, d5hkkm1, d5hkkm3, d5hkkn1, d5hkkn3, d5hkko_
   automated match to d2qe7d2
   complexed with adp, atp, gol, mg, po4

Details for d5hkkl2

PDB Entry: 5hkk, 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)

PDB Compounds: (L:) ATP synthase subunit beta

SCOPe Domain Sequences for d5hkkl2:

Sequence; same for both SEQRES and ATOM records:

>d5hkkl2 c.37.1.11 (L:77-349) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
isvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeelstadeiletgikvid
llapyakggkiglfggagvgktvliqelinnvaqehgglsvfagvgertregndlyhemk
dsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvllfidnifrftqagse
vsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyvpaddytdpapattfa
hldattnlerklaemgiypavdplastsrilsp

Timeline for d5hkkl2:

• d5hkkl2 first appeared in SCOPe 2.06
  
• d5hkkl2 appears in SCOPe 2.07