SCOPe 2.08: Domain d5daya1: 5day A:19-224

Lineage for d5daya1 (5day A:19-224)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.305: NAP-like [143112] (1 superfamily)
   core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix

4. Superfamily d.305.1: NAP-like [143113] (2 families)

5. Family d.305.1.0: automated matches [196445] (1 protein)
   not a true family

6. Protein automated matches [196446] (6 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [322879] (2 PDB entries)

8. Domain d5daya1: 5day A:19-224 [322880]
   Other proteins in same PDB: d5daya2, d5dayb2
   automated match to d2e50b_
   complexed with ca

Details for d5daya1

PDB Entry: 5day, 2.33 Å

PDB Description: the structure of nap1-related protein(nrp1) in arabidopsis

PDB Compounds: (A:) NAP1-related protein 1

SCOPe Domain Sequences for d5daya1:

Sequence, based on SEQRES records:

>d5daya1 d.305.1.0 (A:19-224) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsip
gfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedakl
tktftfleegttkitatpikwkegkglpngvnhddkkgnkralpeesfftwftdaqhked
agdeihdevadiikedlwsnpltyfn

Sequence, based on observed residues (ATOM records):

>d5daya1 d.305.1.0 (A:19-224) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsip
gfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedakl
tktftflegttkitatpikwkegsfftwfthdevadiikedlwsnpltyfn

Timeline for d5daya1:

• d5daya1 first appeared in SCOPe 2.06
  
• d5daya1 appears in SCOPe 2.07