Lineage for d5daya1 (5day A:19-224)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216056Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2216057Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2216070Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 2216071Protein automated matches [196446] (3 species)
    not a true protein
  7. 2279578Species Arabidopsis thaliana [TaxId:3702] [322879] (1 PDB entry)
  8. 2279579Domain d5daya1: 5day A:19-224 [322880]
    Other proteins in same PDB: d5daya2, d5dayb2
    automated match to d2e50b_
    complexed with ca

Details for d5daya1

PDB Entry: 5day (more details), 2.33 Å

PDB Description: the structure of nap1-related protein(nrp1) in arabidopsis
PDB Compounds: (A:) NAP1-related protein 1

SCOPe Domain Sequences for d5daya1:

Sequence, based on SEQRES records: (download)

>d5daya1 d.305.1.0 (A:19-224) automated matches {Arabidopsis thaliana [TaxId: 3702]}
nleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsip
gfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedakl
tktftfleegttkitatpikwkegkglpngvnhddkkgnkralpeesfftwftdaqhked
agdeihdevadiikedlwsnpltyfn

Sequence, based on observed residues (ATOM records): (download)

>d5daya1 d.305.1.0 (A:19-224) automated matches {Arabidopsis thaliana [TaxId: 3702]}
nleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsip
gfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedakl
tktftflegttkitatpikwkegsfftwfthdevadiikedlwsnpltyfn

SCOPe Domain Coordinates for d5daya1:

Click to download the PDB-style file with coordinates for d5daya1.
(The format of our PDB-style files is described here.)

Timeline for d5daya1:

  • d5daya1 appears in periodic updates to SCOPe 2.06 starting on 2016-09-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5daya2