SCOPe 2.06: Domain d5b1bf_: 5b1b F:

Lineage for d5b1bf_ (5b1b F:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries)

8. Domain d5b1bf_: 5b1b F: [322838]
   Other proteins in same PDB: d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bt_, d5b1bu_, d5b1bv_, d5b1bw_, d5b1bx_, d5b1by_, d5b1bz_
   automated match to d1v54f_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5b1bf_

PDB Entry: 5b1b, 1.6 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution

PDB Compounds: (F:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5b1bf_:

Sequence; same for both SEQRES and ATOM records:

>d5b1bf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d5b1bf_:

• d5b1bf_ is new in SCOPe 2.06-stable
  
• d5b1bf_ appears in SCOPe 2.07
  
• d5b1bf_ appears in the current release, SCOPe 2.08