Lineage for d4zcra_ (4zcr A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469343Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)
  8. 2469344Domain d4zcra_: 4zcr A: [322807]
    automated match to d1coza_
    complexed with pc

Details for d4zcra_

PDB Entry: 4zcr (more details), 1.8 Å

PDB Description: crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with phosphocholine
PDB Compounds: (A:) Cholinephosphate cytidylyltransferase

SCOPe Domain Sequences for d4zcra_:

Sequence, based on SEQRES records: (download)

>d4zcra_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilk

Sequence, based on observed residues (ATOM records): (download)

>d4zcra_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahdddiyawlkragkfkatqrtegvstt
dlivrilk

SCOPe Domain Coordinates for d4zcra_:

Click to download the PDB-style file with coordinates for d4zcra_.
(The format of our PDB-style files is described here.)

Timeline for d4zcra_: