SCOPe 2.08: Domain d5ljyh1: 5ljy H:6-113

Lineage for d5ljyh1 (5ljy H:6-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ljyh1: 5ljy H:6-113 [322788]
   Other proteins in same PDB: d5ljyh2
   automated match to d1mfah1
   complexed with nag, nco

Details for d5ljyh1

PDB Entry: 5ljy, 3 Å

PDB Description: structure of hantavirus envelope glycoprotein gc in complex with scfv a5

PDB Compounds: (H:) scFvA5

SCOPe Domain Sequences for d5ljyh1:

Sequence; same for both SEQRES and ATOM records:

>d5ljyh1 b.1.1.0 (H:6-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltcvvsggsisssnwwswvrqppgkglewigeiyhsgspnynpslk
srvtisvdksknqfslklssvtaadtavyycarqmrqwgqgtlvtvss

Timeline for d5ljyh1:

• d5ljyh1 first appeared in SCOPe 2.06, called d5ljyh_
  
• d5ljyh1 appears in SCOPe 2.07