Lineage for d4zcpa_ (4zcp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860976Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [322782] (1 PDB entry)
  8. 2860977Domain d4zcpa_: 4zcp A: [322783]
    automated match to d1coza_
    complexed with c5p

Details for d4zcpa_

PDB Entry: 4zcp (more details), 1.98 Å

PDB Description: crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cmp
PDB Compounds: (A:) Cholinephosphate cytidylyltransferase

SCOPe Domain Sequences for d4zcpa_:

Sequence, based on SEQRES records: (download)

>d4zcpa_ c.26.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilk

Sequence, based on observed residues (ATOM records): (download)

>d4zcpa_ c.26.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddidiyawlkragkfkatqrtegvst
tdlivrilk

SCOPe Domain Coordinates for d4zcpa_:

Click to download the PDB-style file with coordinates for d4zcpa_.
(The format of our PDB-style files is described here.)

Timeline for d4zcpa_: