SCOPe 2.08: Domain d4xxua_: 4xxu A:

Lineage for d4xxua_ (4xxu A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [322769] (10 PDB entries)

8. Domain d4xxua_: 4xxu A: [322770]
   automated match to d1amfa_
   complexed with cq4

Details for d4xxua_

PDB Entry: 4xxu, 1.43 Å

PDB Description: moda - chromate bound

PDB Compounds: (A:) Molybdate-binding periplasmic protein

SCOPe Domain Sequences for d4xxua_:

Sequence; same for both SEQRES and ATOM records:

>d4xxua_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw
mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh
vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv
vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik

Timeline for d4xxua_:

• d4xxua_ first appeared in SCOPe 2.06
  
• d4xxua_ appears in SCOPe 2.07