Lineage for d5kojd_ (5koj D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484691Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2484798Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2485108Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2485109Protein automated matches [190944] (37 species)
    not a true protein
  7. 2485156Species Gluconacetobacter diazotrophicus [TaxId:272568] [322644] (2 PDB entries)
  8. 2485160Domain d5kojd_: 5koj D: [322766]
    Other proteins in same PDB: d5koja_, d5kojc_
    automated match to d3u7qb_
    complexed with clf, fe, hca, ics

Details for d5kojd_

PDB Entry: 5koj (more details), 2.59 Å

PDB Description: nitrogenase mofep protein in the ids oxidized state
PDB Compounds: (D:) Nitrogenase FeMo beta subunit protein NifK

SCOPe Domain Sequences for d5kojd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kojd_ c.92.2.0 (D:) automated matches {Gluconacetobacter diazotrophicus [TaxId: 272568]}
pqnvdkildhaplfrepeyqemlagkaklenmppadkvveiadwtksweyreknfaresl
svnpakacqplgavfvasgfertmsfvhgsqgcvayyrshlsrhfkepssavsssmteda
avfgglnnmvdglantyklydpkmiavsttcmaevigddlhafiqtakgkgsvpeefdvp
fahtpafvgshvtgydnmlkgilehfwkgrtpvpnrsvniipgfdgfavgnnrelkrilg
mmgvqytilsdvsdqfdtpsdgeyrmydggtkieaardavnadytislqeyctpktleyc
qsfgqktasfhyplgigatddllqklseisgkpvpqelemergrlvdaladsqaylhgkt
yaiygdpdfvygmarfiletggepkhclatngskaweaqmqelfdsspfgvgckawggkd
lwhmrsllatekvdllignsygkylerdtdtplirlmfpifdrhhhhrfpvwgyqgalrv
lvtlldkifdkldddtiqagvtdysfdltr

SCOPe Domain Coordinates for d5kojd_:

Click to download the PDB-style file with coordinates for d5kojd_.
(The format of our PDB-style files is described here.)

Timeline for d5kojd_: