SCOPe 2.08: Domain d4zcta_: 4zct A:

Lineage for d4zcta_ (4zct A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)

8. Domain d4zcta_: 4zct A: [322749]
   automated match to d1coza_

Details for d4zcta_

PDB Entry: 4zct, 2.22 Å

PDB Description: crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase

PDB Compounds: (A:) Cholinephosphate cytidylyltransferase

SCOPe Domain Sequences for d4zcta_:

Sequence, based on SEQRES records:

>d4zcta_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilknyedy

Sequence, based on observed residues (ATOM records):

>d4zcta_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahdddiyawlkragkfkatqrtegvstt
dlivrilknyedy

Timeline for d4zcta_:

• d4zcta_ first appeared in SCOPe 2.06
  
• d4zcta_ appears in SCOPe 2.07