Lineage for d5llsa1 (5lls A:40-508)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076457Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2076570Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2076571Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2076840Protein automated matches [226889] (3 species)
    not a true protein
  7. 2076863Species Sus scrofa [TaxId:9823] [322689] (1 PDB entry)
  8. 2076864Domain d5llsa1: 5lls A:40-508 [322736]
    Other proteins in same PDB: d5llsa2, d5llsb2, d5llsc2, d5llsd2
    automated match to d1orva1
    complexed with 6z8, nag, so4

Details for d5llsa1

PDB Entry: 5lls (more details), 2.41 Å

PDB Description: porcine dipeptidyl peptidase iv in complex with 8-(3-aminopiperidin-1- yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1h- purine-2,6-dione
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5llsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llsa1 b.70.3.1 (A:40-508) automated matches {Sus scrofa [TaxId: 9823]}
rrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdelg
ystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitwsp
vghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlspn
asvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwis
svarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfitk
gawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyysa
sfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d5llsa1:

Click to download the PDB-style file with coordinates for d5llsa1.
(The format of our PDB-style files is described here.)

Timeline for d5llsa1: