Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein automated matches [190995] (8 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [322712] (1 PDB entry) |
Domain d5lira1: 5lir A:5-220 [322713] Other proteins in same PDB: d5lira2 automated match to d1vhqa_ complexed with peg |
PDB Entry: 5lir (more details), 1.75 Å
SCOPe Domain Sequences for d5lira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lira1 c.23.16.2 (A:5-220) automated matches {Salmonella enterica [TaxId: 90371]} kkigvvlsgcgvydgteiheavltllaiarsgaqavcfapdkpqadvinhltgeamaetr nvlieaaritrgdirplsqaqpeeldalivpggfgaaknlsnfasqgsecrvdsdvvala kamhqsgkplgficiapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivvd ednkvvttpaymlaqdiaqaasgidklvsrvlvlae
Timeline for d5lira1: