Lineage for d5lira1 (5lir A:5-220)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858933Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2859095Protein automated matches [190995] (8 species)
    not a true protein
  7. 2859108Species Salmonella enterica [TaxId:90371] [322712] (1 PDB entry)
  8. 2859109Domain d5lira1: 5lir A:5-220 [322713]
    Other proteins in same PDB: d5lira2
    automated match to d1vhqa_
    complexed with peg

Details for d5lira1

PDB Entry: 5lir (more details), 1.75 Å

PDB Description: structure of the salty sigma cross-reacting protein 27a (scrp-27a) from salmonella typhimurium
PDB Compounds: (A:) Sigma cross-reacting protein 27A (SCRP-27A)

SCOPe Domain Sequences for d5lira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lira1 c.23.16.2 (A:5-220) automated matches {Salmonella enterica [TaxId: 90371]}
kkigvvlsgcgvydgteiheavltllaiarsgaqavcfapdkpqadvinhltgeamaetr
nvlieaaritrgdirplsqaqpeeldalivpggfgaaknlsnfasqgsecrvdsdvvala
kamhqsgkplgficiapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivvd
ednkvvttpaymlaqdiaqaasgidklvsrvlvlae

SCOPe Domain Coordinates for d5lira1:

Click to download the PDB-style file with coordinates for d5lira1.
(The format of our PDB-style files is described here.)

Timeline for d5lira1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lira2