Lineage for d5l79a1 (5l79 A:106-263)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529736Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2529737Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2529806Domain d5l79a1: 5l79 A:106-263 [322697]
    Other proteins in same PDB: d5l79a2
    automated match to d4i03a_
    complexed with 6pj, ca, edo, gol, r47, zn

Details for d5l79a1

PDB Entry: 5l79 (more details), 2.07 Å

PDB Description: crystal structure of mmp12 in complex with rxp470.1 conjugated with fluorophore cy5,5 in space group p21212.
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d5l79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l79a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d5l79a1:

Click to download the PDB-style file with coordinates for d5l79a1.
(The format of our PDB-style files is described here.)

Timeline for d5l79a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l79a2