Lineage for d5kojc_ (5koj C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484691Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2484798Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2484872Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2484999Protein automated matches [190199] (3 species)
    not a true protein
  7. 2485054Species Gluconacetobacter diazotrophicus [TaxId:272568] [322657] (2 PDB entries)
  8. 2485058Domain d5kojc_: 5koj C: [322688]
    Other proteins in same PDB: d5kojb_, d5kojd_
    automated match to d1fp4a_
    complexed with clf, fe, hca, ics

Details for d5kojc_

PDB Entry: 5koj (more details), 2.59 Å

PDB Description: nitrogenase mofep protein in the ids oxidized state
PDB Compounds: (C:) Nitrogenase protein alpha chain

SCOPe Domain Sequences for d5kojc_:

Sequence, based on SEQRES records: (download)

>d5kojc_ c.92.2.3 (C:) automated matches {Gluconacetobacter diazotrophicus [TaxId: 272568]}
dktndsafharliaevleaypdkarkrrqkhlnvagqaeaeaqdageegvmlsecdvksn
vksvpgvmtirgcayagskgvvwgpvkdmvhishgpvgcgqyswsqrrnyyigntgvdsf
vtmqftsdfqekdivfggdkklekiideidelfplakgisvqsecpigligddieavsrk
kkkeigktivpvrcegfrgvsqslghhiandairdwvfdgedkhaafettpydvnvigdy
niggdawssrilleemglrvvgnwsgdatlaeierapkaklnlihcyrsmnyicrhmeek
ynipwteynffgpsqiaaslrkiaalfdekiqegaerviakyqplvdaviekfrprlagk
kvmlyvgglrprhvvnayndlgmeivgtgyefghnddyqrtghyvregtliyddvtgyel
ekfiegirpdlvgsgikekypvqkmgipfrqmhswdysgpyhgydgfaifardmdlainn
pvwsmfkapw

Sequence, based on observed residues (ATOM records): (download)

>d5kojc_ c.92.2.3 (C:) automated matches {Gluconacetobacter diazotrophicus [TaxId: 272568]}
dktndsafharliaevleaypdkarkrrqkhlnvagqagvmlsecdvksnvksvpgvmti
rgcayagskgvvwgpvkdmvhishgpvgcgqyswsqrrnyyigntgvdsfvtmqftsdfq
ekdivfggdkklekiideidelfplakgisvqsecpigligddieavsrkkkkeigktiv
pvrcegfrgvsqslghhiandairdwvfdgedkhaafettpydvnvigdyniggdawssr
illeemglrvvgnwsgdatlaeierapkaklnlihcyrsmnyicrhmeekynipwteynf
fgpsqiaaslrkiaalfdekiqegaerviakyqplvdaviekfrprlagkkvmlyvgglr
prhvvnayndlgmeivgtgyefghnddyqrtghyvregtliyddvtgyelekfiegirpd
lvgsgikekypvqkmgipfrqmhswdysgpyhgydgfaifardmdlainnpvwsmfkapw

SCOPe Domain Coordinates for d5kojc_:

Click to download the PDB-style file with coordinates for d5kojc_.
(The format of our PDB-style files is described here.)

Timeline for d5kojc_: