Lineage for d5kvva1 (5kvv A:3-156)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847786Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)
  8. 2847800Domain d5kvva1: 5kvv A:3-156 [322686]
    Other proteins in same PDB: d5kvva2, d5kvvb2
    automated match to d4tvoa1
    complexed with gol, nai, so4, trs

Details for d5kvva1

PDB Entry: 5kvv (more details), 2.01 Å

PDB Description: structure of malate dehydrogenase in complex with nadh from mycobacterium tuberculosis
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5kvva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvva1 c.2.1.0 (A:3-156) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddca
fpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaa
ddvrvgvtgnpantnaliamtnapdiprerfsal

SCOPe Domain Coordinates for d5kvva1:

Click to download the PDB-style file with coordinates for d5kvva1.
(The format of our PDB-style files is described here.)

Timeline for d5kvva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kvva2