Lineage for d5khga_ (5khg A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082008Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2082153Protein automated matches [190352] (8 species)
    not a true protein
  7. 2082203Species Mouse (Mus musculus) [TaxId:10090] [187178] (8 PDB entries)
  8. 2082215Domain d5khga_: 5khg A: [322678]
    automated match to d3u10a_
    complexed with cc7

Details for d5khga_

PDB Entry: 5khg (more details), 2.24 Å

PDB Description: hcn2 cnbd in complex with cytidine-3', 5'-cyclic monophosphate (ccmp)
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d5khga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5khga_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrigkknsil

SCOPe Domain Coordinates for d5khga_:

Click to download the PDB-style file with coordinates for d5khga_.
(The format of our PDB-style files is described here.)

Timeline for d5khga_: