SCOPe 2.08: Domain d5ixyb2: 5ixy B:160-331

Lineage for d5ixyb2 (5ixy B:160-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries)

8. Domain d5ixyb2: 5ixy B:160-331 [322673]
   Other proteins in same PDB: d5ixya1, d5ixyb1, d5ixyc1, d5ixyd1
   automated match to d4jnka2
   complexed with gn2, nad, so4

Details for d5ixyb2

PDB Entry: 5ixy, 3 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4- oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixyb2:

Sequence; same for both SEQRES and ATOM records:

>d5ixyb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d5ixyb2:

• d5ixyb2 first appeared in SCOPe 2.06
  
• d5ixyb2 appears in SCOPe 2.07